PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 249aa    MW: 28687.7 Da    PI: 6.715
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03503.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-091752111955
                 HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +k +yps++++  LA+++gL+++q+ +WF N+R ++
  KHN03503.1 175 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 211
                 45679*****************************885 PP

2ELK38.91.9e-13131151121
         ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                 ELK qLlrKY+gyLgsLkqEF
  KHN03503.1 131 ELKGQLLRKYRGYLGSLKQEF 151
                 9*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037902.7E-17134IPR005540KNOX1
SMARTSM012559.8E-12138IPR005540KNOX1
SMARTSM012562.0E-264394IPR005541KNOX2
PfamPF037916.6E-234693IPR005541KNOX2
PfamPF037893.5E-9131151IPR005539ELK domain
SMARTSM011885.9E-7131152IPR005539ELK domain
PROSITE profilePS5121311.139131151IPR005539ELK domain
PROSITE profilePS5007113.167151214IPR001356Homeobox domain
SuperFamilySSF466899.41E-20153229IPR009057Homeodomain-like
SMARTSM003891.2E-12153218IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-28156216IPR009057Homeodomain-like
CDDcd000863.72E-12163215No hitNo description
PfamPF059203.8E-17171210IPR008422Homeobox KN domain
PROSITE patternPS000270189212IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MAHPHYHRLL AAYVNCQKVG APPEVMGRLE EACASAAVTM AGGTASIGED PELDQFMEAY  60
CEMLIKYEQE LSKPFKEAML FLQRIECQFK SLTISSSLDT TACNEAIDRN GSSDDVDVQT  120
NIIDPQAEDQ ELKGQLLRKY RGYLGSLKQE FTKKRKKGKL PKEARQQLLE WWSRHYKWPY  180
PSESQKLALA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF VVVDPSHPHY YMENVLGNPF  240
PMNLSHTML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146155LKQEFTKKRK
2152156KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8573390.0DQ857339.1 Glycine max KNT1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237352.11e-174KNT1
SwissprotP466081e-148HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLK7MJC60.0K7MJC6_SOYBN; Uncharacterized protein
STRINGGLYMA17G01370.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-129KNOX/ELK homeobox transcription factor